PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013893735.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Chlorophyceae; Sphaeropleales; Selenastraceae; Monoraphidium
Family MYB
Protein Properties Length: 561aa    MW: 58811.6 Da    PI: 8.0389
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013893735.1genomeBUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.57.3e-092022322245
                      T........-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  22 g........tWktIartmgkgRtlkqcksrwq 45 
                                W+ +a++++ gRt+ qc  rw+
   XP_013893735.1 202 AraqgkvgnKWSEVAKHIP-GRTGQQCAQRWR 232
                      3555555555*********.***********8 PP

2Myb_DNA-binding521.6e-16241287148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      r++WT++Ed  l d+vk +G g W+ Iar+m+ gRt+ qc  rw+ +l
   XP_013893735.1 241 RDKWTEDEDSHLMDLVKTFGIGKWAEIARHMQ-GRTDQQCMGRWRRHL 287
                      789*****************************.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF523744.02E-465204No hitNo description
Gene3DG3DSA:3.40.50.6202.6E-327108IPR014729Rossmann-like alpha/beta/alpha sandwich fold
PRINTSPR010392.1E-95980IPR002306Tryptophan-tRNA ligase
PfamPF005792.4E-1165136IPR002305Aminoacyl-tRNA synthetase, class Ic
PRINTSPR010392.1E-9103113IPR002306Tryptophan-tRNA ligase
Gene3DG3DSA:1.10.240.103.1E-37109197No hitNo description
PROSITE profilePS500907.352162235IPR017877Myb-like domain
SMARTSM007170.0041180237IPR001005SANT/Myb domain
CDDcd001671.17E-5190232No hitNo description
Gene3DG3DSA:1.10.10.601.3E-16198244IPR009057Homeodomain-like
PfamPF002491.9E-7203232IPR001005SANT/Myb domain
SuperFamilySSF466891.83E-25215294IPR009057Homeodomain-like
PROSITE profilePS5129425.346236291IPR017930Myb domain
SMARTSM007174.5E-14240289IPR001005SANT/Myb domain
PfamPF002496.5E-14241287IPR001005SANT/Myb domain
CDDcd001671.72E-13243287No hitNo description
Gene3DG3DSA:1.10.10.601.4E-20245295IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006436Biological Processtryptophanyl-tRNA aminoacylation
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
GO:0004830Molecular Functiontryptophan-tRNA ligase activity
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 561 aa     Download sequence    Send to blast
MKSVERRLTR CVSGNQVKGI FGLTLDDCIG KIAFPAVQAA PSFPGCFPHI FGDRRDVRCL  60
IPCAIDQDPY FRMTRDVAPR LGYAKPALIE SRFFPALQGE SGKMSASDPN SAIFVNDTPK  120
QIKDKITKYA FSGGGATLEE HRARGANLDV DVPWKYLNFF MEDDDRLAHI GREYGSGRML  180
TGEIKGELTR LLTDIVARHQ AARAQGKVGN KWSEVAKHIP GRTGQQCAQR WRHKVNPNIR  240
RDKWTEDEDS HLMDLVKTFG IGKWAEIARH MQGRTDQQCM GRWRRHLDPA IRRSTSRRRF  300
DSSDSDDEDD LDDALTESDV DGGAEADGDG DAGALDGADA PPAPACSGGS GGSAVHVKPE  360
PCALGAPEVA TAAAGPGPAA ACGAGRDQHM MGGESDAGDG RGGGESGGGG GGGDDHGAHP  420
HAAEEEAAGM VGRAADSVLA SARRRLAARK QQQQAGYGGP AAFAPLSPPR RPPRGPAPLP  480
AAAACGGMST PKKGAGRVLD SPGAGIMSPS LMSPPASAQR LSAGGGGGYE GGEPAGWQRS  540
SAAAAATSSR PARRRCVAAT S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1o5t_A1e-887205160358Tryptophanyl-tRNA synthetase
1r6t_A5e-887205253451Tryptophanyl-tRNA synthetase
1r6t_B5e-887205253451Tryptophanyl-tRNA synthetase
1r6u_A5e-887205206404Tryptophanyl-tRNA synthetase
1r6u_B5e-887205206404Tryptophanyl-tRNA synthetase
1ulh_A2e-887205172370Tryptophanyl-tRNA synthetase
1ulh_B2e-887205172370Tryptophanyl-tRNA synthetase
2ake_A1e-887205160358Tryptophanyl-tRNA synthetase
2dr2_A1e-887205160358Tryptophanyl-tRNA synthetase
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013893735.10.0tryptophanyl-tRNA synthetase
TrEMBLA0A0D2MIB70.0A0A0D2MIB7_9CHLO; Tryptophanyl-tRNA synthetase
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02320.24e-19myb domain protein 3r-5
Publications ? help Back to Top
  1. Bogen C, et al.
    Reconstruction of the lipid metabolism for the microalga Monoraphidium neglectum from its genome sequence reveals characteristics suitable for biofuel production.
    BMC Genomics, 2013. 14: p. 926
    [PMID:24373495]